PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG066300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25200.9 Da    PI: 9.8264
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG066300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.58.2e-244288248
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         r en   r vtfskRr+g+lKKA ELSvLC+a+v viifsstgk+++
  Pavir.3NG066300.2.p 42 RTENPVHRRVTFSKRREGLLKKARELSVLCGADVGVIIFSSTGKVHD 88
                         67999****************************************97 PP

2K-box16.34.2e-071171921389
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           ++  +q ++ L+ ei  Lq+ +R   G + e++ l  L+ Le+ Le    + Rs K+++l++  e lq+k +e+++
  Pavir.3NG066300.2.p 117 RSQVTEQWISLLRHEIGLLQHGLRSTGGGE-ENMRLDRLHVLEKGLELWYCQTRSAKEDILKAANEILQNKANEQNQ 192
                          45667788999***********87766655.9***************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-333392IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.743393IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-2733108IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-233555IPR002100Transcription factor, MADS-box
CDDcd002656.92E-3435110No hitNo description
PfamPF003192.7E-224487IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-235570IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-237091IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MCVRQAGACL QLVPYLLQGQ SKVKVICRQR ETMVRGKVQM RRTENPVHRR VTFSKRREGL  60
LKKARELSVL CGADVGVIIF SSTGKVHDLA TNGNMQSLVE RYQSIAARGK MESKNLRSQV  120
TEQWISLLRH EIGLLQHGLR STGGGEENMR LDRLHVLEKG LELWYCQTRS AKEDILKAAN  180
EILQNKANEQ NQFMSNCSVF SGSSYSTHYD ANESCLFTIY SF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.418881e-38leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700445.19e-86PREDICTED: MADS-box transcription factor 33-like
SwissprotQ2QW553e-69MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLI1ITN11e-76I1ITN1_BRADI; MADS-box transcription factor 34
STRINGBRADI4G40357.14e-76(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-37AGAMOUS-like 12